PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARF
Protein Properties Length: 496aa    MW: 54839.6 Da    PI: 7.8322
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34036genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.13.8e-19491113599
                                EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                         B3  35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                                 l+++d +g +We+++iyr++++r++lt+GW++Fv+ ++L +gD+vvF+  +++++ ++v+++r+
  Tp57577_TGAC_v2_mRNA34036  49 SLSITDVHGLTWEFRHIYRGTPRRHLLTTGWSRFVNCKKLVAGDSVVFM--KNNRGAMFVGIRRA 111
                                68899********************************************..6789999****996 PP

2Auxin_resp84.22.8e-28184260883
                 Auxin_resp   8 ksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrl.sGtvvgvsdldpvrWpnSkWrsLk 83 
                                 ++FevvY+P+a++s+Fv k+e v +a++v +++GmR+kma+et+ds ++++ +G+v++v+  +   W++S+Wr+L+
  Tp57577_TGAC_v2_mRNA34036 184 XMAFEVVYYPKAGWSDFVLKAEVVDAAMSVTWCPGMRIKMAVETDDSCRTTWfQGLVASVNVPEHGAWRGSPWRMLE 260
                                578************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010196.2E-713112IPR003340B3 DNA binding domain
SuperFamilySSF1019361.83E-1545110IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-1648111IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-1948113IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.23750112IPR003340B3 DNA binding domain
CDDcd100174.46E-1252110No hitNo description
PfamPF065071.1E-24184259IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MMERGFLRLR RFLLLLMLTT AVDFPFRGFV LIRFSLRLII XXXXXXXXSL SITDVHGLTW  60
EFRHIYRGTP RRHLLTTGWS RFVNCKKLVA GDSVVFMKNN RGAMFVGIRR AVRFVLARSC  120
VGSDATRLCL PICGVRNRVD DEEDEKLLEE KCREGFSRNG KGKLSPNSVT VAAXXXXXXX  180
XXXXMAFEVV YYPKAGWSDF VLKAEVVDAA MSVTWCPGMR IKMAVETDDS CRTTWFQGLV  240
ASVNVPEHGA WRGSPWRMLE ISWDEPEVSQ TSKWVSPWQV ELLSTTPSLH RPFPAMKRIR  300
VGSGVLTDGD GDSFSITGFN NSTMGQLSQE LLNYGTLPAG MQGARHDLFS VSSFSNFPGD  360
NSRLCMGNTF SNNSVPGLKS LSTELNVGSS QSSDFSPESQ SSLRSFGTDF VRNLNCNSMK  420
PGPVSFQLFG AVIQTEQPVE SGSHGTGSSG DDSSKGCNDT EGINNALEDS FTYSKLLGRL  480
DGQCQIASTV EACYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-2850281198388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601137.10.0auxin response factor, putative
TrEMBLG7J4630.0G7J463_MEDTR; Auxin response factor
STRINGGLYMA04G43350.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40303056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77850.12e-92auxin response factor 17